Placeholder image of a protein
Icon representing a puzzle

1674: Revisiting Puzzle 136: Cell Adhesion

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 10,028
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,932
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,924
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,844
  5. Avatar for HMT heritage 5. HMT heritage 24 pts. 9,799
  6. Avatar for Go Science 6. Go Science 16 pts. 9,793
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 9,704
  8. Avatar for Russian team 8. Russian team 6 pts. 9,591
  9. Avatar for Contenders 9. Contenders 4 pts. 9,535
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 9,474
  1. Avatar for IHGreenman 81. IHGreenman Lv 1 3 pts. 8,487
  2. Avatar for kludbrook 82. kludbrook Lv 1 2 pts. 8,466
  3. Avatar for tarimo 83. tarimo Lv 1 2 pts. 8,409
  4. Avatar for Merf 84. Merf Lv 1 2 pts. 8,378
  5. Avatar for ehhan2018 85. ehhan2018 Lv 1 2 pts. 8,377
  6. Avatar for memam2018 86. memam2018 Lv 1 2 pts. 8,375
  7. Avatar for vizhu2018 87. vizhu2018 Lv 1 2 pts. 8,371
  8. Avatar for rabamino12358 88. rabamino12358 Lv 1 2 pts. 8,311
  9. Avatar for traal 89. traal Lv 1 2 pts. 8,293
  10. Avatar for Museka 90. Museka Lv 1 2 pts. 8,272

Comments

vakobo Lv 1

I've got a state in this puzzle when 1 move permanently crashes linux client. Should is share it to scientists?

bkoep Staff Lv 1

Can you also tell us what move causes Foldit to crash? Do you have log.txt output from the crash?

vakobo Lv 1

Save name 'ready to crash'.
Necessary action is described in save comments - pull down rightmost cysteine which is connected with rubber band to another one.