Placeholder image of a protein
Icon representing a puzzle

1676: Unsolved De-novo Freestyle 152: Symmetric Dimer

Closed since about 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Symmetry Symmetry Symmetry Symmetry Symmetry Symmetry Symmetry Symmetry Symmetry

Summary


Created
May 20, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1673: De-novo Freestyle 152, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1673, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1673. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 14,383
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 13,771
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 13,757
  4. Avatar for Go Science 4. Go Science 30 pts. 13,459
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 19 pts. 13,424
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 13,353
  7. Avatar for Hold My Beer 7. Hold My Beer 7 pts. 13,352
  8. Avatar for freefolder 8. freefolder 4 pts. 13,342
  9. Avatar for Contenders 9. Contenders 2 pts. 13,290
  10. Avatar for Russian team 10. Russian team 1 pt. 13,177

  1. Avatar for actiasluna
    1. actiasluna Lv 1
    100 pts. 14,383
  2. Avatar for Skippysk8s 2. Skippysk8s Lv 1 97 pts. 13,860
  3. Avatar for LociOiling 3. LociOiling Lv 1 93 pts. 13,766
  4. Avatar for tyler0911 4. tyler0911 Lv 1 89 pts. 13,741
  5. Avatar for fiendish_ghoul 5. fiendish_ghoul Lv 1 86 pts. 13,668
  6. Avatar for guineapig 6. guineapig Lv 1 82 pts. 13,565
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 79 pts. 13,424
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 76 pts. 13,418
  9. Avatar for Mike Cassidy 9. Mike Cassidy Lv 1 73 pts. 13,353
  10. Avatar for Steven Pletsch 10. Steven Pletsch Lv 1 70 pts. 13,352

Comments