Placeholder image of a protein
Icon representing a puzzle

1676: Unsolved De-novo Freestyle 152: Symmetric Dimer

Closed since almost 7 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
May 20, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1673: De-novo Freestyle 152, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1673, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1673. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 12,937
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 12,777
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 10,553
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 8,919

  1. Avatar for Skippysk8s
    1. Skippysk8s Lv 1
    100 pts. 14,372
  2. Avatar for actiasluna 2. actiasluna Lv 1 84 pts. 14,365
  3. Avatar for anthion 3. anthion Lv 1 70 pts. 14,313
  4. Avatar for Norrjane 4. Norrjane Lv 1 58 pts. 14,284
  5. Avatar for ManVsYard 5. ManVsYard Lv 1 48 pts. 14,276
  6. Avatar for Blipperman 6. Blipperman Lv 1 39 pts. 13,825
  7. Avatar for StackOverflow 7. StackOverflow Lv 1 32 pts. 13,787
  8. Avatar for LociOiling 8. LociOiling Lv 1 26 pts. 13,771
  9. Avatar for Galaxie 9. Galaxie Lv 1 20 pts. 13,757
  10. Avatar for smilingone 10. smilingone Lv 1 16 pts. 13,756

Comments