Placeholder image of a protein
Icon representing a puzzle

1676: Unsolved De-novo Freestyle 152: Symmetric Dimer

Closed since almost 7 years ago

Intermediate Overall Prediction Symmetry

Summary


Created
May 20, 2019
Expires
Max points
100
Description

This is a follow-up to Puzzle 1673: De-novo Freestyle 152, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1673, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1673. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 12,937
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 12,777
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 10,553
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 8,919

  1. Avatar for abiogenesis 71. abiogenesis Lv 1 2 pts. 11,230
  2. Avatar for Aminal88 72. Aminal88 Lv 1 2 pts. 11,009
  3. Avatar for benrh 73. benrh Lv 1 2 pts. 10,935
  4. Avatar for Sydefecks 74. Sydefecks Lv 1 2 pts. 10,875
  5. Avatar for martin.szew 75. martin.szew Lv 1 2 pts. 10,756
  6. Avatar for Threeoak 76. Threeoak Lv 1 2 pts. 10,742
  7. Avatar for pfirth 77. pfirth Lv 1 2 pts. 10,593
  8. Avatar for zanbato 78. zanbato Lv 1 1 pt. 10,553
  9. Avatar for rabamino12358 79. rabamino12358 Lv 1 1 pt. 10,468
  10. Avatar for thewholeblahthing 80. thewholeblahthing Lv 1 1 pt. 10,431

Comments