Foldit

1676: Unsolved De-novo Freestyle 152: Symmetric Dimer

Closed since almost 7 years ago

Intermediate Overall Prediction Symmetry

Summary

Created: May 20, 2019
Expires: May 27, 2019 at 23:00 UTC
Max points: 100

Description

This is a follow-up to Puzzle 1673: De-novo Freestyle 152, now with C2 symmetry. This protein was originally designed by a Foldit player as a symmetric dimer. In Puzzle 1673, we challenged the Foldit community to try and predict how the design might fold as a single, monomeric chain. Now we want to see if Foldit players can predict how the original protein was designed to fold and bind to itself with C2 symmetry. Players may load in solutions from Puzzle 1673. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!

Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK