Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529

  1. Avatar for multaq 101. multaq Lv 1 1 pt. 10,273
  2. Avatar for thewholeblahthing 102. thewholeblahthing Lv 1 1 pt. 10,269
  3. Avatar for Anamfija 103. Anamfija Lv 1 1 pt. 10,236
  4. Avatar for dd-2 104. dd-2 Lv 1 1 pt. 10,235
  5. Avatar for Savas 105. Savas Lv 1 1 pt. 10,224
  6. Avatar for gdnskye 106. gdnskye Lv 1 1 pt. 10,201
  7. Avatar for MrZanav 107. MrZanav Lv 1 1 pt. 10,191
  8. Avatar for felixxy 108. felixxy Lv 1 1 pt. 10,179
  9. Avatar for dbuske 109. dbuske Lv 1 1 pt. 10,173
  10. Avatar for Simek 110. Simek Lv 1 1 pt. 10,153

Comments