Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,905
  2. Avatar for Contenders 2. Contenders 73 pts. 11,686
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 11,671
  4. Avatar for Go Science 4. Go Science 36 pts. 11,577
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,563
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,508
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,471
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,430
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,420
  10. Avatar for Russian team 10. Russian team 2 pts. 11,355
  1. Avatar for multaq 101. multaq Lv 1 1 pt. 10,273
  2. Avatar for thewholeblahthing 102. thewholeblahthing Lv 1 1 pt. 10,269
  3. Avatar for Anamfija 103. Anamfija Lv 1 1 pt. 10,236
  4. Avatar for dd-2 104. dd-2 Lv 1 1 pt. 10,235
  5. Avatar for Savas 105. Savas Lv 1 1 pt. 10,224
  6. Avatar for gdnskye 106. gdnskye Lv 1 1 pt. 10,201
  7. Avatar for MrZanav 107. MrZanav Lv 1 1 pt. 10,191
  8. Avatar for felixxy 108. felixxy Lv 1 1 pt. 10,179
  9. Avatar for dbuske 109. dbuske Lv 1 1 pt. 10,173
  10. Avatar for Simek 110. Simek Lv 1 1 pt. 10,153

Comments