Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 11,156
  2. Avatar for DW 2020 12. DW 2020 1 pt. 10,940
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,938
  4. Avatar for freefolder 14. freefolder 1 pt. 10,677
  5. Avatar for Extraterrestrials 2.0 15. Extraterrestrials 2.0 1 pt. 10,615
  6. Avatar for Eὕρηκα! Heureka! 16. Eὕρηκα! Heureka! 1 pt. 10,224
  7. Avatar for CH4110 Fold it! 17. CH4110 Fold it! 1 pt. 9,529

  1. Avatar for jobo0502 11. jobo0502 Lv 1 69 pts. 11,508
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 66 pts. 11,500
  3. Avatar for smilingone 13. smilingone Lv 1 64 pts. 11,484
  4. Avatar for robgee 14. robgee Lv 1 61 pts. 11,473
  5. Avatar for fpc 15. fpc Lv 1 59 pts. 11,471
  6. Avatar for Blipperman 16. Blipperman Lv 1 56 pts. 11,455
  7. Avatar for georg137 17. georg137 Lv 1 54 pts. 11,454
  8. Avatar for phi16 18. phi16 Lv 1 52 pts. 11,453
  9. Avatar for MicElephant 19. MicElephant Lv 1 50 pts. 11,443
  10. Avatar for frood66 20. frood66 Lv 1 48 pts. 11,437

Comments