Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,905
  2. Avatar for Contenders 2. Contenders 73 pts. 11,686
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 11,671
  4. Avatar for Go Science 4. Go Science 36 pts. 11,577
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,563
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,508
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,471
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,430
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,420
  10. Avatar for Russian team 10. Russian team 2 pts. 11,355

  1. Avatar for rol 91. rol Lv 1 1 pt. 10,574
  2. Avatar for kludbrook 92. kludbrook Lv 1 1 pt. 10,529
  3. Avatar for abiogenesis 93. abiogenesis Lv 1 1 pt. 10,525
  4. Avatar for memam2018 94. memam2018 Lv 1 1 pt. 10,516
  5. Avatar for harvardman 95. harvardman Lv 1 1 pt. 10,502
  6. Avatar for pfirth 96. pfirth Lv 1 1 pt. 10,390
  7. Avatar for rinze 97. rinze Lv 1 1 pt. 10,348
  8. Avatar for alwan2018 98. alwan2018 Lv 1 1 pt. 10,314
  9. Avatar for ehhan2018 99. ehhan2018 Lv 1 1 pt. 10,314
  10. Avatar for Knoblerine 100. Knoblerine Lv 1 1 pt. 10,277

Comments