Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,376
  2. Avatar for actiasluna 2. actiasluna Lv 1 97 pts. 10,328
  3. Avatar for anthion 3. anthion Lv 1 93 pts. 10,218
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 89 pts. 10,173
  5. Avatar for LociOiling 5. LociOiling Lv 1 86 pts. 10,080
  6. Avatar for silent gene 6. silent gene Lv 1 83 pts. 10,021
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 79 pts. 9,993
  8. Avatar for Galaxie 8. Galaxie Lv 1 76 pts. 9,976
  9. Avatar for Deleted player 9. Deleted player pts. 9,966
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 70 pts. 9,957

Comments