Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,376
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 10,328
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,080
  4. Avatar for Go Science 4. Go Science 27 pts. 10,047
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,993
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 9,900
  7. Avatar for Contenders 7. Contenders 5 pts. 9,839
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,765
  10. Avatar for Russian team 10. Russian team 1 pt. 9,710
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,376
  2. Avatar for actiasluna 2. actiasluna Lv 1 97 pts. 10,328
  3. Avatar for anthion 3. anthion Lv 1 93 pts. 10,218
  4. Avatar for fiendish_ghoul 4. fiendish_ghoul Lv 1 89 pts. 10,173
  5. Avatar for LociOiling 5. LociOiling Lv 1 86 pts. 10,080
  6. Avatar for silent gene 6. silent gene Lv 1 83 pts. 10,021
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 79 pts. 9,993
  8. Avatar for Galaxie 8. Galaxie Lv 1 76 pts. 9,976
  9. Avatar for Deleted player 9. Deleted player pts. 9,966
  10. Avatar for retiredmichael 10. retiredmichael Lv 1 70 pts. 9,957

Comments