Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,376
  2. Avatar for gdnskye 2. gdnskye Lv 1 84 pts. 10,369
  3. Avatar for grogar7 3. grogar7 Lv 1 70 pts. 10,368
  4. Avatar for Deleted player 4. Deleted player pts. 10,367
  5. Avatar for robgee 5. robgee Lv 1 47 pts. 10,348
  6. Avatar for alcor29 6. alcor29 Lv 1 38 pts. 10,344
  7. Avatar for alwen 7. alwen Lv 1 30 pts. 10,333
  8. Avatar for lamoille 8. lamoille Lv 1 24 pts. 10,327
  9. Avatar for actiasluna 9. actiasluna Lv 1 19 pts. 10,326
  10. Avatar for Skippysk8s 10. Skippysk8s Lv 1 15 pts. 10,326

Comments