Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,376
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 10,328
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,080
  4. Avatar for Go Science 4. Go Science 27 pts. 10,047
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,993
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 9,900
  7. Avatar for Contenders 7. Contenders 5 pts. 9,839
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,765
  10. Avatar for Russian team 10. Russian team 1 pt. 9,710
  1. Avatar for ManVsYard 11. ManVsYard Lv 1 11 pts. 10,323
  2. Avatar for Deleted player 12. Deleted player pts. 10,312
  3. Avatar for Norrjane 13. Norrjane Lv 1 7 pts. 10,281
  4. Avatar for Blipperman 14. Blipperman Lv 1 5 pts. 10,179
  5. Avatar for anthion 15. anthion Lv 1 4 pts. 10,162
  6. Avatar for LociOiling 16. LociOiling Lv 1 3 pts. 10,068
  7. Avatar for smilingone 17. smilingone Lv 1 2 pts. 10,066
  8. Avatar for toshiue 18. toshiue Lv 1 1 pt. 10,047
  9. Avatar for silent gene 19. silent gene Lv 1 1 pt. 10,036
  10. Avatar for DodoBird 20. DodoBird Lv 1 1 pt. 10,035

Comments