Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,376
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 10,328
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,080
  4. Avatar for Go Science 4. Go Science 27 pts. 10,047
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,993
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 9,900
  7. Avatar for Contenders 7. Contenders 5 pts. 9,839
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,765
  10. Avatar for Russian team 10. Russian team 1 pt. 9,710
  1. Avatar for Bruno Kestemont 21. Bruno Kestemont Lv 1 1 pt. 10,033
  2. Avatar for Hellcat6 22. Hellcat6 Lv 1 1 pt. 9,795
  3. Avatar for fpc 23. fpc Lv 1 1 pt. 9,765
  4. Avatar for frood66 24. frood66 Lv 1 1 pt. 9,722
  5. Avatar for Alistair69 25. Alistair69 Lv 1 1 pt. 9,710
  6. Avatar for Museka 26. Museka Lv 1 1 pt. 9,669
  7. Avatar for retiredmichael 27. retiredmichael Lv 1 1 pt. 9,661
  8. Avatar for orily1337 28. orily1337 Lv 1 1 pt. 9,591
  9. Avatar for Phyx 29. Phyx Lv 1 1 pt. 9,471

Comments