Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for vakobo 11. vakobo Lv 1 72 pts. 11,311
  2. Avatar for fiendish_ghoul 12. fiendish_ghoul Lv 1 69 pts. 11,281
  3. Avatar for crpainter 13. crpainter Lv 1 67 pts. 11,264
  4. Avatar for jobo0502 14. jobo0502 Lv 1 65 pts. 11,254
  5. Avatar for actiasluna 15. actiasluna Lv 1 62 pts. 11,244
  6. Avatar for frood66 16. frood66 Lv 1 60 pts. 11,238
  7. Avatar for grogar7 17. grogar7 Lv 1 58 pts. 11,232
  8. Avatar for robgee 18. robgee Lv 1 56 pts. 11,227
  9. Avatar for silent gene 19. silent gene Lv 1 54 pts. 11,219
  10. Avatar for cbwest 20. cbwest Lv 1 52 pts. 11,200

Comments