Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,528
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,515
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,490
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,437
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,417
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,411
  7. Avatar for Russian team 7. Russian team 7 pts. 11,311
  8. Avatar for Contenders 8. Contenders 4 pts. 11,264
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 11,254
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,244
  1. Avatar for vakobo 11. vakobo Lv 1 72 pts. 11,311
  2. Avatar for fiendish_ghoul 12. fiendish_ghoul Lv 1 69 pts. 11,281
  3. Avatar for crpainter 13. crpainter Lv 1 67 pts. 11,264
  4. Avatar for jobo0502 14. jobo0502 Lv 1 65 pts. 11,254
  5. Avatar for actiasluna 15. actiasluna Lv 1 62 pts. 11,244
  6. Avatar for frood66 16. frood66 Lv 1 60 pts. 11,238
  7. Avatar for grogar7 17. grogar7 Lv 1 58 pts. 11,232
  8. Avatar for robgee 18. robgee Lv 1 56 pts. 11,227
  9. Avatar for silent gene 19. silent gene Lv 1 54 pts. 11,219
  10. Avatar for cbwest 20. cbwest Lv 1 52 pts. 11,200

Comments