Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for johnmitch 21. johnmitch Lv 1 50 pts. 11,118
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 48 pts. 11,070
  3. Avatar for anthion 23. anthion Lv 1 47 pts. 11,066
  4. Avatar for monteecristo 24. monteecristo Lv 1 45 pts. 11,059
  5. Avatar for pvc78 25. pvc78 Lv 1 43 pts. 11,052
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 41 pts. 11,031
  7. Avatar for nicobul 27. nicobul Lv 1 40 pts. 11,029
  8. Avatar for stomjoh 28. stomjoh Lv 1 38 pts. 11,028
  9. Avatar for Museka 29. Museka Lv 1 37 pts. 10,988
  10. Avatar for Deleted player 30. Deleted player 35 pts. 10,982

Comments