Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,528
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,515
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,490
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,437
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,417
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,411
  7. Avatar for Russian team 7. Russian team 7 pts. 11,311
  8. Avatar for Contenders 8. Contenders 4 pts. 11,264
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 11,254
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,244
  1. Avatar for johnmitch 21. johnmitch Lv 1 50 pts. 11,118
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 48 pts. 11,070
  3. Avatar for anthion 23. anthion Lv 1 47 pts. 11,066
  4. Avatar for monteecristo 24. monteecristo Lv 1 45 pts. 11,059
  5. Avatar for pvc78 25. pvc78 Lv 1 43 pts. 11,052
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 41 pts. 11,031
  7. Avatar for nicobul 27. nicobul Lv 1 40 pts. 11,029
  8. Avatar for stomjoh 28. stomjoh Lv 1 38 pts. 11,028
  9. Avatar for Museka 29. Museka Lv 1 37 pts. 10,988
  10. Avatar for Deleted player 30. Deleted player 35 pts. 10,982

Comments