Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 11,116
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 10,271
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 9,914
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,874
  5. Avatar for ABG_UNIVR 15. ABG_UNIVR 1 pt. 0
  1. Avatar for 15SecNut 71. 15SecNut Lv 1 5 pts. 10,449
  2. Avatar for kribol76 72. kribol76 Lv 1 5 pts. 10,432
  3. Avatar for heather-1 73. heather-1 Lv 1 5 pts. 10,429
  4. Avatar for Origami314 74. Origami314 Lv 1 4 pts. 10,424
  5. Avatar for IHGreenman 75. IHGreenman Lv 1 4 pts. 10,407
  6. Avatar for lconor 76. lconor Lv 1 4 pts. 10,377
  7. Avatar for cobaltteal 77. cobaltteal Lv 1 4 pts. 10,376
  8. Avatar for Willyanto 78. Willyanto Lv 1 4 pts. 10,364
  9. Avatar for yasmin_waydzik 79. yasmin_waydzik Lv 1 3 pts. 10,354
  10. Avatar for rabamino12358 80. rabamino12358 Lv 1 3 pts. 10,340

Comments