Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,528
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,515
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,490
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,437
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,417
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,411
  7. Avatar for Russian team 7. Russian team 7 pts. 11,311
  8. Avatar for Contenders 8. Contenders 4 pts. 11,264
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 11,254
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,244
  1. Avatar for 15SecNut 71. 15SecNut Lv 1 5 pts. 10,449
  2. Avatar for kribol76 72. kribol76 Lv 1 5 pts. 10,432
  3. Avatar for heather-1 73. heather-1 Lv 1 5 pts. 10,429
  4. Avatar for Origami314 74. Origami314 Lv 1 4 pts. 10,424
  5. Avatar for IHGreenman 75. IHGreenman Lv 1 4 pts. 10,407
  6. Avatar for lconor 76. lconor Lv 1 4 pts. 10,377
  7. Avatar for cobaltteal 77. cobaltteal Lv 1 4 pts. 10,376
  8. Avatar for Willyanto 78. Willyanto Lv 1 4 pts. 10,364
  9. Avatar for yasmin_waydzik 79. yasmin_waydzik Lv 1 3 pts. 10,354
  10. Avatar for rabamino12358 80. rabamino12358 Lv 1 3 pts. 10,340

Comments