Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,528
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,515
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,490
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,437
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,417
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,411
  7. Avatar for Russian team 7. Russian team 7 pts. 11,311
  8. Avatar for Contenders 8. Contenders 4 pts. 11,264
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 11,254
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,244
  1. Avatar for teeben 141. teeben Lv 1 1 pt. 7,357
  2. Avatar for wilsonliu 142. wilsonliu Lv 1 1 pt. 6,481
  3. Avatar for RockOn 143. RockOn Lv 1 1 pt. 6,352
  4. Avatar for Tehnologik1 144. Tehnologik1 Lv 1 1 pt. 6,336
  5. Avatar for Vitriol Steven 145. Vitriol Steven Lv 1 1 pt. 4,111
  6. Avatar for abg-2019 146. abg-2019 Lv 1 1 pt. 0
  7. Avatar for altejoh 147. altejoh Lv 1 1 pt. 0
  8. Avatar for lamoille 148. lamoille Lv 1 1 pt. 0
  9. Avatar for Bletchley Park 149. Bletchley Park Lv 1 1 pt. 0
  10. Avatar for Flagg65a 150. Flagg65a Lv 1 1 pt. 0

Comments