Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,528
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,515
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,490
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,437
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,417
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,411
  7. Avatar for Russian team 7. Russian team 7 pts. 11,311
  8. Avatar for Contenders 8. Contenders 4 pts. 11,264
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 11,254
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,244
  1. Avatar for manu8170 101. manu8170 Lv 1 1 pt. 10,088
  2. Avatar for ScyllaHide 102. ScyllaHide Lv 1 1 pt. 10,046
  3. Avatar for drjr 103. drjr Lv 1 1 pt. 10,024
  4. Avatar for snoopydawg7 104. snoopydawg7 Lv 1 1 pt. 10,016
  5. Avatar for MOMISBACK 105. MOMISBACK Lv 1 1 pt. 9,990
  6. Avatar for hajtogato 106. hajtogato Lv 1 1 pt. 9,985
  7. Avatar for Divisor11 107. Divisor11 Lv 1 1 pt. 9,975
  8. Avatar for fenecoo 108. fenecoo Lv 1 1 pt. 9,961
  9. Avatar for Csani24 109. Csani24 Lv 1 1 pt. 9,953
  10. Avatar for LPFsioc 110. LPFsioc Lv 1 1 pt. 9,941

Comments