Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,643
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,621
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,555
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 10,501
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,418
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 10,327
  7. Avatar for Contenders 7. Contenders 10 pts. 10,320
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 10,282
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,159
  10. Avatar for Russian team 10. Russian team 2 pts. 10,006
  1. Avatar for NinjaGreg
    1. NinjaGreg Lv 1
    100 pts. 10,634
  2. Avatar for Galaxie 2. Galaxie Lv 1 97 pts. 10,555
  3. Avatar for LociOiling 3. LociOiling Lv 1 93 pts. 10,555
  4. Avatar for Timo van der Laan 4. Timo van der Laan Lv 1 90 pts. 10,501
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 86 pts. 10,492
  6. Avatar for johnmitch 6. johnmitch Lv 1 83 pts. 10,434
  7. Avatar for nicobul 7. nicobul Lv 1 80 pts. 10,418
  8. Avatar for silent gene 8. silent gene Lv 1 77 pts. 10,371
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 74 pts. 10,358
  10. Avatar for tyler0911 10. tyler0911 Lv 1 71 pts. 10,356

Comments