Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,575
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,135
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,796
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,478
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,369
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,432
  7. Avatar for Window Group 17. Window Group 1 pt. 4,813

  1. Avatar for boondog 91. boondog Lv 1 1 pt. 8,093
  2. Avatar for hajtogato 92. hajtogato Lv 1 1 pt. 8,034
  3. Avatar for jamiexq 93. jamiexq Lv 1 1 pt. 7,925
  4. Avatar for IHGreenman 94. IHGreenman Lv 1 1 pt. 7,901
  5. Avatar for donuts554 95. donuts554 Lv 1 1 pt. 7,747
  6. Avatar for Dantoto 96. Dantoto Lv 1 1 pt. 7,662
  7. Avatar for leoli1989 97. leoli1989 Lv 1 1 pt. 7,653
  8. Avatar for Knoblerine 98. Knoblerine Lv 1 1 pt. 7,644
  9. Avatar for Mizraim 99. Mizraim Lv 1 1 pt. 7,608
  10. Avatar for rabamino12358 100. rabamino12358 Lv 1 1 pt. 7,604

Comments