Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,575
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,135
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,796
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,478
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,369
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,432
  7. Avatar for Window Group 17. Window Group 1 pt. 4,813
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 68 pts. 10,345
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 65 pts. 10,325
  3. Avatar for crpainter 13. crpainter Lv 1 63 pts. 10,320
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 60 pts. 10,287
  5. Avatar for Phyx 15. Phyx Lv 1 58 pts. 10,281
  6. Avatar for joremen 16. joremen Lv 1 55 pts. 10,270
  7. Avatar for Blipperman 17. Blipperman Lv 1 53 pts. 10,267
  8. Avatar for aznarog 18. aznarog Lv 1 51 pts. 10,254
  9. Avatar for retiredmichael 19. retiredmichael Lv 1 49 pts. 10,254
  10. Avatar for frood66 20. frood66 Lv 1 46 pts. 10,249

Comments