Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,575
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,135
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,796
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,478
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,369
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,432
  7. Avatar for Window Group 17. Window Group 1 pt. 4,813

  1. Avatar for vakobo 41. vakobo Lv 1 17 pts. 10,006
  2. Avatar for TastyMunchies 42. TastyMunchies Lv 1 16 pts. 9,975
  3. Avatar for gurch 43. gurch Lv 1 15 pts. 9,973
  4. Avatar for Satina 44. Satina Lv 1 14 pts. 9,945
  5. Avatar for manu8170 45. manu8170 Lv 1 14 pts. 9,938
  6. Avatar for anthion 46. anthion Lv 1 13 pts. 9,897
  7. Avatar for toshiue 47. toshiue Lv 1 12 pts. 9,890
  8. Avatar for Deleted player 48. Deleted player pts. 9,868
  9. Avatar for phi16 49. phi16 Lv 1 11 pts. 9,786
  10. Avatar for Keresto 50. Keresto Lv 1 10 pts. 9,756

Comments