Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,575
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,135
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,796
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,478
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,369
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,432
  7. Avatar for Window Group 17. Window Group 1 pt. 4,813
  1. Avatar for PeterDav 61. PeterDav Lv 1 5 pts. 9,415
  2. Avatar for Hellcat6 62. Hellcat6 Lv 1 5 pts. 9,377
  3. Avatar for KingLear 63. KingLear Lv 1 5 pts. 9,349
  4. Avatar for alcor29 64. alcor29 Lv 1 4 pts. 9,323
  5. Avatar for lconor 65. lconor Lv 1 4 pts. 9,276
  6. Avatar for kentish_alex 66. kentish_alex Lv 1 4 pts. 9,273
  7. Avatar for abiogenesis 67. abiogenesis Lv 1 4 pts. 9,186
  8. Avatar for Pawel Tluscik 68. Pawel Tluscik Lv 1 3 pts. 9,184
  9. Avatar for Hiro Protagonist 69. Hiro Protagonist Lv 1 3 pts. 9,135
  10. Avatar for cobaltteal 70. cobaltteal Lv 1 3 pts. 9,088

Comments