Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,575
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,135
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,796
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,478
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,369
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,432
  7. Avatar for Window Group 17. Window Group 1 pt. 4,813
  1. Avatar for dbuske 71. dbuske Lv 1 3 pts. 9,027
  2. Avatar for Arne Heessels 72. Arne Heessels Lv 1 3 pts. 9,002
  3. Avatar for Flagg65a 73. Flagg65a Lv 1 2 pts. 8,998
  4. Avatar for rol 74. rol Lv 1 2 pts. 8,977
  5. Avatar for Willyanto 75. Willyanto Lv 1 2 pts. 8,969
  6. Avatar for ManVsYard 76. ManVsYard Lv 1 2 pts. 8,951
  7. Avatar for Merf 77. Merf Lv 1 2 pts. 8,929
  8. Avatar for ViJay7019 78. ViJay7019 Lv 1 2 pts. 8,919
  9. Avatar for ourtown 79. ourtown Lv 1 2 pts. 8,917
  10. Avatar for Squirrely 80. Squirrely Lv 1 2 pts. 8,888

Comments