Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,575
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,135
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,796
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,478
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,369
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,432
  7. Avatar for Window Group 17. Window Group 1 pt. 4,813

  1. Avatar for alyssa_d 81. alyssa_d Lv 1 1 pt. 8,796
  2. Avatar for dd-2 82. dd-2 Lv 1 1 pt. 8,777
  3. Avatar for kludbrook 83. kludbrook Lv 1 1 pt. 8,719
  4. Avatar for Altercomp 84. Altercomp Lv 1 1 pt. 8,709
  5. Avatar for rinze 85. rinze Lv 1 1 pt. 8,656
  6. Avatar for 15SecNut 86. 15SecNut Lv 1 1 pt. 8,575
  7. Avatar for harvardman 87. harvardman Lv 1 1 pt. 8,499
  8. Avatar for zanbato 88. zanbato Lv 1 1 pt. 8,478
  9. Avatar for Steven Pletsch 89. Steven Pletsch Lv 1 1 pt. 8,369
  10. Avatar for Noosfera 90. Noosfera Lv 1 1 pt. 8,260

Comments