Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for Go Science 100 pts. 10,643
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,621
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,555
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 10,501
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,418
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 10,327
  7. Avatar for Contenders 7. Contenders 10 pts. 10,320
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 10,282
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,159
  10. Avatar for Russian team 10. Russian team 2 pts. 10,006

  1. Avatar for seulkicho 131. seulkicho Lv 1 1 pt. 0
  2. Avatar for lamoille 132. lamoille Lv 1 1 pt. 0
  3. Avatar for Ferruccio 133. Ferruccio Lv 1 1 pt. 0

Comments