Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,643
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 10,621
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,555
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 10,501
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 24 pts. 10,418
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 10,327
  7. Avatar for Contenders 7. Contenders 10 pts. 10,320
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 10,282
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,159
  10. Avatar for Russian team 10. Russian team 2 pts. 10,006
  1. Avatar for jausmh 51. jausmh Lv 1 10 pts. 9,718
  2. Avatar for drumpeter18yrs9yrs 52. drumpeter18yrs9yrs Lv 1 9 pts. 9,624
  3. Avatar for benrh 53. benrh Lv 1 9 pts. 9,586
  4. Avatar for kitek314_pl 54. kitek314_pl Lv 1 8 pts. 9,575
  5. Avatar for martin.kendig@verizon.net 55. martin.kendig@verizon.net Lv 1 8 pts. 9,479
  6. Avatar for cbwest 56. cbwest Lv 1 7 pts. 9,474
  7. Avatar for DoctorSockrates 57. DoctorSockrates Lv 1 7 pts. 9,458
  8. Avatar for georg137 58. georg137 Lv 1 6 pts. 9,443
  9. Avatar for Deleted player 59. Deleted player pts. 9,438
  10. Avatar for drjr 60. drjr Lv 1 6 pts. 9,417

Comments