Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777
  1. Avatar for Galaxie 11. Galaxie Lv 1 68 pts. 10,337
  2. Avatar for crpainter 12. crpainter Lv 1 65 pts. 10,335
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 62 pts. 10,333
  4. Avatar for Anfinsen_slept_here 14. Anfinsen_slept_here Lv 1 60 pts. 10,302
  5. Avatar for jobo0502 15. jobo0502 Lv 1 57 pts. 10,266
  6. Avatar for johnmitch 16. johnmitch Lv 1 55 pts. 10,259
  7. Avatar for robgee 17. robgee Lv 1 53 pts. 10,245
  8. Avatar for Deleted player 18. Deleted player pts. 10,244
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 48 pts. 10,239
  10. Avatar for toshiue 20. toshiue Lv 1 46 pts. 10,236

Comments