Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,555
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,508
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,505
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,501
  5. Avatar for Go Science 5. Go Science 16 pts. 10,444
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,335
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,239
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,132
  10. Avatar for Russian team 10. Russian team 1 pt. 9,994
  1. Avatar for Galaxie 11. Galaxie Lv 1 68 pts. 10,337
  2. Avatar for crpainter 12. crpainter Lv 1 65 pts. 10,335
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 62 pts. 10,333
  4. Avatar for Anfinsen_slept_here 14. Anfinsen_slept_here Lv 1 60 pts. 10,302
  5. Avatar for jobo0502 15. jobo0502 Lv 1 57 pts. 10,266
  6. Avatar for johnmitch 16. johnmitch Lv 1 55 pts. 10,259
  7. Avatar for robgee 17. robgee Lv 1 53 pts. 10,245
  8. Avatar for Deleted player 18. Deleted player pts. 10,244
  9. Avatar for Timo van der Laan 19. Timo van der Laan Lv 1 48 pts. 10,239
  10. Avatar for toshiue 20. toshiue Lv 1 46 pts. 10,236

Comments