Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,527
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,008
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 8,911
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,777
  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 1 pt. 8,785
  2. Avatar for alyssa_d 82. alyssa_d Lv 1 1 pt. 8,777
  3. Avatar for IHGreenman 83. IHGreenman Lv 1 1 pt. 8,736
  4. Avatar for Pawel Tluscik 84. Pawel Tluscik Lv 1 1 pt. 8,722
  5. Avatar for Arne Heessels 85. Arne Heessels Lv 1 1 pt. 8,714
  6. Avatar for Biochemica 86. Biochemica Lv 1 1 pt. 8,678
  7. Avatar for Willyanto 87. Willyanto Lv 1 1 pt. 8,663
  8. Avatar for Datstandin 88. Datstandin Lv 1 1 pt. 8,600
  9. Avatar for rezaefar 89. rezaefar Lv 1 1 pt. 8,579
  10. Avatar for helen88 90. helen88 Lv 1 1 pt. 8,573

Comments