Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0
  1. Avatar for rezaefar 101. rezaefar Lv 1 1 pt. 8,469
  2. Avatar for ManVsYard 102. ManVsYard Lv 1 1 pt. 8,441
  3. Avatar for ourtown 103. ourtown Lv 1 1 pt. 8,269
  4. Avatar for Dhalion 104. Dhalion Lv 1 1 pt. 8,082
  5. Avatar for JugrenisII 105. JugrenisII Lv 1 1 pt. 7,861
  6. Avatar for Willyanto 106. Willyanto Lv 1 1 pt. 7,846
  7. Avatar for iveenp 107. iveenp Lv 1 1 pt. 7,510
  8. Avatar for Biochemica 108. Biochemica Lv 1 1 pt. 7,476
  9. Avatar for Anamfija 109. Anamfija Lv 1 1 pt. 7,150
  10. Avatar for reidlchem 110. reidlchem Lv 1 1 pt. 6,492

Comments