Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736
  1. Avatar for rezaefar 101. rezaefar Lv 1 1 pt. 8,469
  2. Avatar for ManVsYard 102. ManVsYard Lv 1 1 pt. 8,441
  3. Avatar for ourtown 103. ourtown Lv 1 1 pt. 8,269
  4. Avatar for Dhalion 104. Dhalion Lv 1 1 pt. 8,082
  5. Avatar for JugrenisII 105. JugrenisII Lv 1 1 pt. 7,861
  6. Avatar for Willyanto 106. Willyanto Lv 1 1 pt. 7,846
  7. Avatar for iveenp 107. iveenp Lv 1 1 pt. 7,510
  8. Avatar for Biochemica 108. Biochemica Lv 1 1 pt. 7,476
  9. Avatar for Anamfija 109. Anamfija Lv 1 1 pt. 7,150
  10. Avatar for reidlchem 110. reidlchem Lv 1 1 pt. 6,492

Comments