Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0
  1. Avatar for ScyllaHide 111. ScyllaHide Lv 1 1 pt. 6,375
  2. Avatar for eleonora.zelioli 112. eleonora.zelioli Lv 1 1 pt. 6,187
  3. Avatar for Martinaa 113. Martinaa Lv 1 1 pt. 6,149
  4. Avatar for Puttering 114. Puttering Lv 1 1 pt. 5,886
  5. Avatar for 01010011111 115. 01010011111 Lv 1 1 pt. 4,751
  6. Avatar for kevinugg 116. kevinugg Lv 1 1 pt. 0
  7. Avatar for lamoille 117. lamoille Lv 1 1 pt. 0
  8. Avatar for aspadistra 118. aspadistra Lv 1 1 pt. 0
  9. Avatar for Ricc_100 119. Ricc_100 Lv 1 1 pt. 0
  10. Avatar for Hollinas 120. Hollinas Lv 1 1 pt. 0

Comments