Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736
  1. Avatar for ScyllaHide 111. ScyllaHide Lv 1 1 pt. 6,375
  2. Avatar for eleonora.zelioli 112. eleonora.zelioli Lv 1 1 pt. 6,187
  3. Avatar for Martinaa 113. Martinaa Lv 1 1 pt. 6,149
  4. Avatar for Puttering 114. Puttering Lv 1 1 pt. 5,886
  5. Avatar for 01010011111 115. 01010011111 Lv 1 1 pt. 4,751
  6. Avatar for kevinugg 116. kevinugg Lv 1 1 pt. 0
  7. Avatar for lamoille 117. lamoille Lv 1 1 pt. 0
  8. Avatar for aspadistra 118. aspadistra Lv 1 1 pt. 0
  9. Avatar for Ricc_100 119. Ricc_100 Lv 1 1 pt. 0
  10. Avatar for Hollinas 120. Hollinas Lv 1 1 pt. 0

Comments