Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,731
  2. Avatar for Team China 12. Team China 1 pt. 9,192
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,124
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 8,789
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 0
  1. Avatar for silent gene 21. silent gene Lv 1 41 pts. 9,786
  2. Avatar for YeshuaLives 22. YeshuaLives Lv 1 39 pts. 9,782
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 37 pts. 9,781
  4. Avatar for manu8170 24. manu8170 Lv 1 35 pts. 9,773
  5. Avatar for johnmitch 25. johnmitch Lv 1 33 pts. 9,762
  6. Avatar for frood66 26. frood66 Lv 1 32 pts. 9,756
  7. Avatar for Vinara 27. Vinara Lv 1 30 pts. 9,743
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 28 pts. 9,742
  9. Avatar for Norrjane 29. Norrjane Lv 1 27 pts. 9,741
  10. Avatar for dcrwheeler 30. dcrwheeler Lv 1 26 pts. 9,737

Comments