Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736
  1. Avatar for silent gene 21. silent gene Lv 1 41 pts. 9,786
  2. Avatar for YeshuaLives 22. YeshuaLives Lv 1 39 pts. 9,782
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 37 pts. 9,781
  4. Avatar for manu8170 24. manu8170 Lv 1 35 pts. 9,773
  5. Avatar for johnmitch 25. johnmitch Lv 1 33 pts. 9,762
  6. Avatar for frood66 26. frood66 Lv 1 32 pts. 9,756
  7. Avatar for Vinara 27. Vinara Lv 1 30 pts. 9,743
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 28 pts. 9,742
  9. Avatar for Norrjane 29. Norrjane Lv 1 27 pts. 9,741
  10. Avatar for dcrwheeler 30. dcrwheeler Lv 1 26 pts. 9,737

Comments