Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736

  1. Avatar for LociOiling 11. LociOiling Lv 1 65 pts. 9,862
  2. Avatar for vakobo 12. vakobo Lv 1 62 pts. 9,856
  3. Avatar for nicobul 13. nicobul Lv 1 60 pts. 9,849
  4. Avatar for Keresto 14. Keresto Lv 1 57 pts. 9,832
  5. Avatar for Steven Pletsch 15. Steven Pletsch Lv 1 54 pts. 9,819
  6. Avatar for guineapig 16. guineapig Lv 1 52 pts. 9,813
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 49 pts. 9,811
  8. Avatar for phi16 18. phi16 Lv 1 47 pts. 9,802
  9. Avatar for grogar7 19. grogar7 Lv 1 45 pts. 9,800
  10. Avatar for aznarog 20. aznarog Lv 1 43 pts. 9,790

Comments