Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,117
  2. Avatar for phi16 2. phi16 Lv 1 79 pts. 10,107
  3. Avatar for Museka 3. Museka Lv 1 61 pts. 10,092
  4. Avatar for Alistair69 4. Alistair69 Lv 1 47 pts. 10,092
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 35 pts. 10,088
  6. Avatar for toshiue 6. toshiue Lv 1 26 pts. 10,087
  7. Avatar for ManVsYard 7. ManVsYard Lv 1 19 pts. 10,086
  8. Avatar for actiasluna 8. actiasluna Lv 1 14 pts. 10,085
  9. Avatar for silent gene 9. silent gene Lv 1 10 pts. 10,085
  10. Avatar for LociOiling 10. LociOiling Lv 1 7 pts. 10,085

Comments