Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for gurch 31. gurch Lv 1 23 pts. 9,783
  2. Avatar for phi16 32. phi16 Lv 1 21 pts. 9,765
  3. Avatar for robgee 33. robgee Lv 1 20 pts. 9,745
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 19 pts. 9,731
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 18 pts. 9,731
  6. Avatar for PeterDav 36. PeterDav Lv 1 17 pts. 9,725
  7. Avatar for Museka 37. Museka Lv 1 16 pts. 9,690
  8. Avatar for diamonddays 38. diamonddays Lv 1 15 pts. 9,689
  9. Avatar for anthion 39. anthion Lv 1 14 pts. 9,670
  10. Avatar for Merf 40. Merf Lv 1 13 pts. 9,657

Comments