Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for Hellcat6 71. Hellcat6 Lv 1 1 pt. 9,012
  2. Avatar for stephendl102 72. stephendl102 Lv 1 1 pt. 8,998
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 1 pt. 8,982
  4. Avatar for rinze 74. rinze Lv 1 1 pt. 8,980
  5. Avatar for dahast.de 75. dahast.de Lv 1 1 pt. 8,960
  6. Avatar for JasperD 76. JasperD Lv 1 1 pt. 8,953
  7. Avatar for pfirth 77. pfirth Lv 1 1 pt. 8,945
  8. Avatar for ourtown 78. ourtown Lv 1 1 pt. 8,932
  9. Avatar for highfive 79. highfive Lv 1 1 pt. 8,931
  10. Avatar for jamiexq 80. jamiexq Lv 1 1 pt. 8,914

Comments