Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457

  1. Avatar for Blipperman 11. Blipperman Lv 1 4 pts. 10,081
  2. Avatar for Anfinsen_slept_here 12. Anfinsen_slept_here Lv 1 3 pts. 10,077
  3. Avatar for lamoille 13. lamoille Lv 1 2 pts. 10,067
  4. Avatar for robgee 14. robgee Lv 1 1 pt. 10,066
  5. Avatar for Deleted player 15. Deleted player 1 pt. 10,061
  6. Avatar for Keresto 16. Keresto Lv 1 1 pt. 10,048
  7. Avatar for fpc 17. fpc Lv 1 1 pt. 10,047
  8. Avatar for alcor29 18. alcor29 Lv 1 1 pt. 10,025
  9. Avatar for jausmh 19. jausmh Lv 1 1 pt. 10,018
  10. Avatar for retiredmichael 20. retiredmichael Lv 1 1 pt. 10,013

Comments