Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,827
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 9,570
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,334
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,292
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,974
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 64 pts. 10,101
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 61 pts. 10,070
  3. Avatar for actiasluna 13. actiasluna Lv 1 58 pts. 10,044
  4. Avatar for LociOiling 14. LociOiling Lv 1 55 pts. 10,033
  5. Avatar for silent gene 15. silent gene Lv 1 52 pts. 10,031
  6. Avatar for drumpeter18yrs9yrs 16. drumpeter18yrs9yrs Lv 1 50 pts. 10,026
  7. Avatar for spvincent 17. spvincent Lv 1 47 pts. 10,026
  8. Avatar for jobo0502 18. jobo0502 Lv 1 45 pts. 10,012
  9. Avatar for Anfinsen_slept_here 19. Anfinsen_slept_here Lv 1 43 pts. 9,976
  10. Avatar for Keresto 20. Keresto Lv 1 41 pts. 9,971

Comments