Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,827
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 9,570
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,334
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,292
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,974
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0
  1. Avatar for georg137 41. georg137 Lv 1 12 pts. 9,763
  2. Avatar for Vinara 42. Vinara Lv 1 11 pts. 9,733
  3. Avatar for anthion 43. anthion Lv 1 11 pts. 9,663
  4. Avatar for manu8170 44. manu8170 Lv 1 10 pts. 9,630
  5. Avatar for Squirrely 45. Squirrely Lv 1 9 pts. 9,614
  6. Avatar for Glen B 46. Glen B Lv 1 9 pts. 9,609
  7. Avatar for Aminal88 47. Aminal88 Lv 1 8 pts. 9,603
  8. Avatar for phi16 48. phi16 Lv 1 8 pts. 9,589
  9. Avatar for Merf 49. Merf Lv 1 7 pts. 9,578
  10. Avatar for Cloudy101 50. Cloudy101 Lv 1 7 pts. 9,570

Comments