Placeholder image of a protein
Icon representing a puzzle

1697: Unsolved De-novo Freestyle 155

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
July 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PESALRRYVALRMMLYLMRKGGLRPNEVREVRNKVKKIWEDRDEGKLTPEGFTEKLEQILRELVKKVRERQEKKK

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,827
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 9,570
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 9,334
  4. Avatar for BOINC@Poland 14. BOINC@Poland 1 pt. 9,292
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,974
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 0

  1. Avatar for lconor 81. lconor Lv 1 1 pt. 8,894
  2. Avatar for jdmclure 82. jdmclure Lv 1 1 pt. 8,772
  3. Avatar for ZyongT 83. ZyongT Lv 1 1 pt. 8,772
  4. Avatar for rezaefar 84. rezaefar Lv 1 1 pt. 8,747
  5. Avatar for Silvercraft 85. Silvercraft Lv 1 1 pt. 8,669
  6. Avatar for Vojtenzi CZE 86. Vojtenzi CZE Lv 1 1 pt. 8,526
  7. Avatar for IPD_Alanine 87. IPD_Alanine Lv 1 1 pt. 8,419
  8. Avatar for Bautho 88. Bautho Lv 1 1 pt. 8,327
  9. Avatar for Wuzzie 89. Wuzzie Lv 1 1 pt. 8,274
  10. Avatar for ourtown 90. ourtown Lv 1 1 pt. 8,233

Comments