Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,729
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,661
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 11,424
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 11,251
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 11,218
  6. Avatar for GUGITBIOTECH 16. GUGITBIOTECH 1 pt. 10,973
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 10,176
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 10,009
  9. Avatar for Deleted group 19. Deleted group pts. 4,514
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 12,789
  2. Avatar for Deleted player 2. Deleted player pts. 12,741
  3. Avatar for alcor29 3. alcor29 Lv 1 54 pts. 12,705
  4. Avatar for robgee 4. robgee Lv 1 38 pts. 12,702
  5. Avatar for Deleted player 5. Deleted player 27 pts. 12,695
  6. Avatar for LociOiling 6. LociOiling Lv 1 18 pts. 12,692
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 12 pts. 12,687
  8. Avatar for jausmh 8. jausmh Lv 1 8 pts. 12,556
  9. Avatar for fpc 9. fpc Lv 1 5 pts. 12,521
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 3 pts. 12,459

Comments