Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,789
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 12,695
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 12,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 12,556
  5. Avatar for Go Science 5. Go Science 29 pts. 12,460
  6. Avatar for Contenders 6. Contenders 20 pts. 12,414
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,381
  8. Avatar for Russian team 8. Russian team 9 pts. 12,197
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 12,051
  10. Avatar for Hold My Beer 10. Hold My Beer 4 pts. 11,905
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 12,767
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 12,687
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 93 pts. 12,674
  4. Avatar for tyler0911 4. tyler0911 Lv 1 90 pts. 12,591
  5. Avatar for jobo0502 5. jobo0502 Lv 1 86 pts. 12,574
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 83 pts. 12,496
  7. Avatar for robgee 7. robgee Lv 1 80 pts. 12,460
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 77 pts. 12,460
  9. Avatar for frood66 9. frood66 Lv 1 74 pts. 12,456
  10. Avatar for crpainter 10. crpainter Lv 1 71 pts. 12,414

Comments